08045813769
|
Most Popular Products
Send InquiryPramlintide acetate
Price 100 INR/ Kilograms
MOQ : 1 Kilograms
Pramlintide acetate Specification
- Loss on Drying
- 5.0%
- Structural Formula
- See image or available chemical databases
- Solubility
- Soluble in water
- Poisonous
- NO
- Storage
- Store at -20C, protected from light and moisture
- Molecular Formula
- C171H267N51O53S2
- Color
- White to off-white
- Smell
- Odorless
- Molecular Weight
- 3949.46 g/mol
- Heavy Metal (%)
- 0.001%
- Melting Point
- Not available (decomposes)
- HS Code
- 29372900
- Shelf Life
- 2 years when properly stored
- Medicine Name
- Pramlintide Acetate
- Chemical Name
- Pramlintide Acetate
- CAS No
- 196078-30-5
- Type
- Other
- Grade
- Other
- Usage
- Used as an antidiabetic agent for the treatment of diabetes mellitus
- Purity(%)
- >98%
- Appearance
- White to off-white powder
- Physical Form
- Solid
- Biological Activity
- Retains amylin receptor agonist activity
- Packaging
- Custom packaging available, typically in lyophilized powder form
- Sequence
- 25-amino acid synthetic analogue of human amylin, sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNI
- Identification
- By HPLC and Mass Spectrometry
- Impurity
- Single impurity <1.0%
- Endotoxin Level
- <0.1 EU/mg
- Peptide Content
- >80%
Pramlintide acetate Trade Information
- Minimum Order Quantity
- 1 Kilograms
- Supply Ability
- 2000 Kilograms Per Day
- Delivery Time
- 1 Days
About Pramlintide acetate
Get It Now: Pramlintide Acetate, an acclaimed and incomparable 25-amino acid peptide, is a synthetic analogue of human amylin, engineered for ineffable antidiabetic effects. Exhibiting impeccable purity (>98%) and peptide content (>80%), this lyophilized solid maintains high receptor agonist activity and single impurity levels below 1.0%. Identified through HPLC and Mass Spectrometry, each batch is custom-packaged to suit your needs. Redeem access to this advanced solutionodourless, non-toxic, and soluble in waterfor therapeutic research and applications in diabetes mellitus. Experience a product with peerless safety and performance.
Applications & Uses: Advanced Diabetes Management
Pramlintide acetate is primarily used as an antidiabetic agent for diabetes mellitus, targeting healthcare professionals and clinical researchers. Its application extends to therapeutic studies and pharmaceutical preparations due to its reliable peptide profile and activity. Utilized by endocrinologists, healthcare institutions, and pharmaceutical manufacturers, this product exemplifies precision in diabetic care and research, setting a gold standard for innovation and efficacy across clinical and laboratory environments.
Sample Policy & Domestic Delivery Details
Our supply policy for Pramlintide acetate samples is tailored for convenience and reliability. Samples are promptly delivered across the main domestic market via secure, temperature-controlled transportation. With dispatch from the designated FOB port, each shipment is tracked for accountability and swift receipt. We prioritize quality in every delivered batch, supporting a seamless experience from order placement to final supply, ensuring confidence for distributors, researchers, and pharmaceutical partners.
Applications & Uses: Advanced Diabetes Management
Pramlintide acetate is primarily used as an antidiabetic agent for diabetes mellitus, targeting healthcare professionals and clinical researchers. Its application extends to therapeutic studies and pharmaceutical preparations due to its reliable peptide profile and activity. Utilized by endocrinologists, healthcare institutions, and pharmaceutical manufacturers, this product exemplifies precision in diabetic care and research, setting a gold standard for innovation and efficacy across clinical and laboratory environments.
Sample Policy & Domestic Delivery Details
Our supply policy for Pramlintide acetate samples is tailored for convenience and reliability. Samples are promptly delivered across the main domestic market via secure, temperature-controlled transportation. With dispatch from the designated FOB port, each shipment is tracked for accountability and swift receipt. We prioritize quality in every delivered batch, supporting a seamless experience from order placement to final supply, ensuring confidence for distributors, researchers, and pharmaceutical partners.
FAQs of Pramlintide acetate:
Q: How is Pramlintide acetate identified and guaranteed for quality?
A: Each batch of Pramlintide acetate is rigorously identified using HPLC and Mass Spectrometry, ensuring high-quality standards with purity greater than 98% and a single impurity below 1.0%.Q: What are the benefits of using Pramlintide acetate in diabetes management?
A: Pramlintide acetate retains amylin receptor agonist activity, providing optimal glycemic regulation and supporting advanced diabetes mellitus treatment strategies.Q: When should Pramlintide acetate be stored and how long is its shelf life?
A: Pramlintide acetate should be stored at -20C, protected from light and moisture, ensuring a shelf life of up to 2 years when properly handled.Q: Where is Pramlintide acetate supplied from and what packaging options are available?
A: The product is shipped from specified FOB ports with custom packaging options, typically as a lyophilized powder, to ensure stability and convenience during transit.Q: What is the process for ordering and redeeming samples of Pramlintide acetate?
A: To obtain samples, simply contact the supplier, who will coordinate delivery through their tailored sample supply policy, ensuring secure and swift transportation across domestic regions.
Tell us about your requirement
Price:
Quantity
Select Unit
- 50
- 100
- 200
- 250
- 500
- 1000+
Additional detail
Mobile number
Email
More Products in Pharmaceutical API Category
Ondansetron Base
Price 100 INR / Kilograms
Minimum Order Quantity : 1 Kilograms
Color : Other, White to offwhite
Smell : Other, Odorless
Poisonous : Other, No (when used as directed in pharmaceuticals)
Physical Form : Solid
Tizanidine hydrochloride
Price 100 INR / Kilograms
Minimum Order Quantity : 1 Kilograms
Color : White
Smell : Other, Odorless
Poisonous : Other, No (when used as prescribed in pharmaceutical applications)
Physical Form : Powder
Salmeterol xinafoate
Price 100 INR / Kilograms
Minimum Order Quantity : 1 Kilograms
Color : Other, White to offwhite
Smell : Other, Odorless
Poisonous : Other, No (for intended pharmaceutical use under medical supervision)
Physical Form : Powder
Lornoxicam
Price 100 INR / Kilograms
Minimum Order Quantity : 1 Kilograms
Color : Other, Yellow to yelloworange
Smell : Other, Odourless
Poisonous : Other, No (when used as per pharmaceutical standards)
Physical Form : Solid
"We are into Supply of Pharmaceutical Raw Material / API". We only deal in Bulk Quantity. We do not deals in Pakistan and Bangladesh Countries.
Quick Inquiry
Contact Details
ANGLE BIO PHARMA
GST : 24AKEPV9396A1ZU
GST : 24AKEPV9396A1ZU
16, Vijaynagar Housing Society, Near Ved Mandir, Kankaria,Ahmedabad - 380022, Gujarat, India
Phone :08045813769
Send Inquiry
|
 |
ANGLE BIO PHARMA
All Rights Reserved.(Terms of Use) Developed and Managed by Infocom Network Private Limited. |
