Back to top
08045813769
Send SMS Send Inquiry
Pramlintide acetate
Pramlintide acetate

Pramlintide acetate

Price 100 INR/ Kilograms

MOQ : 1 Kilograms

Pramlintide acetate Specification

  • Heavy Metal (%)
  • 0.001%
  • HS Code
  • 29372900
  • Loss on Drying
  • 5.0%
  • Melting Point
  • Not available (decomposes)
  • Solubility
  • Soluble in water
  • Structural Formula
  • See image or available chemical databases
  • Shelf Life
  • 2 years when properly stored
  • Poisonous
  • NO
  • Smell
  • Odorless
  • Molecular Formula
  • C171H267N51O53S2
  • Storage
  • Store at -20C, protected from light and moisture
  • Molecular Weight
  • 3949.46 g/mol
  • Color
  • White to off-white
  • Medicine Name
  • Pramlintide Acetate
  • Chemical Name
  • Pramlintide Acetate
  • CAS No
  • 196078-30-5
  • Type
  • Other
  • Grade
  • Other
  • Usage
  • Used as an antidiabetic agent for the treatment of diabetes mellitus
  • Purity(%)
  • >98%
  • Appearance
  • White to off-white powder
  • Physical Form
  • Solid
  • Impurity
  • Single impurity <1.0%
  • Endotoxin Level
  • <0.1 EU/mg
  • Packaging
  • Custom packaging available, typically in lyophilized powder form
  • Identification
  • By HPLC and Mass Spectrometry
  • Biological Activity
  • Retains amylin receptor agonist activity
  • Peptide Content
  • >80%
  • Sequence
  • 25-amino acid synthetic analogue of human amylin, sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNI
 

Pramlintide acetate Trade Information

  • Minimum Order Quantity
  • 1 Kilograms
  • Supply Ability
  • 2000 Kilograms Per Day
  • Delivery Time
  • 1 Days
 

About Pramlintide acetate



Get It Now: Pramlintide Acetate, an acclaimed and incomparable 25-amino acid peptide, is a synthetic analogue of human amylin, engineered for ineffable antidiabetic effects. Exhibiting impeccable purity (>98%) and peptide content (>80%), this lyophilized solid maintains high receptor agonist activity and single impurity levels below 1.0%. Identified through HPLC and Mass Spectrometry, each batch is custom-packaged to suit your needs. Redeem access to this advanced solutionodourless, non-toxic, and soluble in waterfor therapeutic research and applications in diabetes mellitus. Experience a product with peerless safety and performance.

Applications & Uses: Advanced Diabetes Management

Pramlintide acetate is primarily used as an antidiabetic agent for diabetes mellitus, targeting healthcare professionals and clinical researchers. Its application extends to therapeutic studies and pharmaceutical preparations due to its reliable peptide profile and activity. Utilized by endocrinologists, healthcare institutions, and pharmaceutical manufacturers, this product exemplifies precision in diabetic care and research, setting a gold standard for innovation and efficacy across clinical and laboratory environments.


Sample Policy & Domestic Delivery Details

Our supply policy for Pramlintide acetate samples is tailored for convenience and reliability. Samples are promptly delivered across the main domestic market via secure, temperature-controlled transportation. With dispatch from the designated FOB port, each shipment is tracked for accountability and swift receipt. We prioritize quality in every delivered batch, supporting a seamless experience from order placement to final supply, ensuring confidence for distributors, researchers, and pharmaceutical partners.


FAQs of Pramlintide acetate:


Q: How is Pramlintide acetate identified and guaranteed for quality?

A: Each batch of Pramlintide acetate is rigorously identified using HPLC and Mass Spectrometry, ensuring high-quality standards with purity greater than 98% and a single impurity below 1.0%.

Q: What are the benefits of using Pramlintide acetate in diabetes management?

A: Pramlintide acetate retains amylin receptor agonist activity, providing optimal glycemic regulation and supporting advanced diabetes mellitus treatment strategies.

Q: When should Pramlintide acetate be stored and how long is its shelf life?

A: Pramlintide acetate should be stored at -20C, protected from light and moisture, ensuring a shelf life of up to 2 years when properly handled.

Q: Where is Pramlintide acetate supplied from and what packaging options are available?

A: The product is shipped from specified FOB ports with custom packaging options, typically as a lyophilized powder, to ensure stability and convenience during transit.

Q: What is the process for ordering and redeeming samples of Pramlintide acetate?

A: To obtain samples, simply contact the supplier, who will coordinate delivery through their tailored sample supply policy, ensuring secure and swift transportation across domestic regions.

Tell us about your requirement
product

Price:

Quantity
Select Unit

  • 50
  • 100
  • 200
  • 250
  • 500
  • 1000+
Additional detail
Mobile number

Email

More Products in Pharmaceutical API Category

Griseofulvin .

Griseofulvin .

Price 100 INR / Kilograms

Minimum Order Quantity : 1 Kilograms

Grade : Other

Physical Form : Solid

HS Code : 29329990

Medicine Name : Griseofulvin

Ketoprofen lysinate

Ketoprofen lysinate

Price 100 INR / Kilograms

Minimum Order Quantity : 1 Kilograms

Grade : Other

Physical Form : Solid

HS Code : 29420090

Medicine Name : Ketoprofen Lysinate

Clonidine hydrochloride

Clonidine hydrochloride

Price 100 INR / Kilograms

Minimum Order Quantity : 1 Kilograms

Grade : Other

Physical Form : Solid

HS Code : 29333990

Medicine Name : Clonidine Hydrochloride

Neomycin sulfate

Neomycin sulfate

Price 100 INR / Kilograms

Minimum Order Quantity : 10 Kilograms

Grade : Other

Physical Form : Powder

HS Code : 29419090

Medicine Name : Neomycin Sulfate



"We are into Supply of Pharmaceutical Raw Material / API". We only deal in Bulk Quantity. We do not deals in Pakistan and Bangladesh Countries.