Pramlintide acetate
Pramlintide acetate Specification
- Storage
- Store at -20C, protected from light and moisture
- Color
- White to off-white
- Structural Formula
- See image or available chemical databases
- HS Code
- 29372900
- Heavy Metal (%)
- 0.001%
- Smell
- Odorless
- Loss on Drying
- 5.0%
- Molecular Formula
- C171H267N51O53S2
- Molecular Weight
- 3949.46 g/mol
- Melting Point
- Not available (decomposes)
- Poisonous
- NO
- Solubility
- Soluble in water
- Shelf Life
- 2 years when properly stored
- Medicine Name
- Pramlintide Acetate
- Chemical Name
- Pramlintide Acetate
- CAS No
- 196078-30-5
- Type
- Other
- Grade
- Other
- Usage
- Used as an antidiabetic agent for the treatment of diabetes mellitus
- Purity(%)
- >98%
- Appearance
- White to off-white powder
- Physical Form
- Solid
- Impurity
- Single impurity <1.0%
- Sequence
- 25-amino acid synthetic analogue of human amylin, sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNI
- Endotoxin Level
- <0.1 EU/mg
- Biological Activity
- Retains amylin receptor agonist activity
- Packaging
- Custom packaging available, typically in lyophilized powder form
- Peptide Content
- >80%
- Identification
- By HPLC and Mass Spectrometry
Pramlintide acetate Trade Information
- Minimum Order Quantity
- 1 Kilograms
- Supply Ability
- 2000 Kilograms Per Day
- Delivery Time
- 1 Days
About Pramlintide acetate
Applications & Uses: Advanced Diabetes Management
Pramlintide acetate is primarily used as an antidiabetic agent for diabetes mellitus, targeting healthcare professionals and clinical researchers. Its application extends to therapeutic studies and pharmaceutical preparations due to its reliable peptide profile and activity. Utilized by endocrinologists, healthcare institutions, and pharmaceutical manufacturers, this product exemplifies precision in diabetic care and research, setting a gold standard for innovation and efficacy across clinical and laboratory environments.
Sample Policy & Domestic Delivery Details
Our supply policy for Pramlintide acetate samples is tailored for convenience and reliability. Samples are promptly delivered across the main domestic market via secure, temperature-controlled transportation. With dispatch from the designated FOB port, each shipment is tracked for accountability and swift receipt. We prioritize quality in every delivered batch, supporting a seamless experience from order placement to final supply, ensuring confidence for distributors, researchers, and pharmaceutical partners.
FAQs of Pramlintide acetate:
Q: How is Pramlintide acetate identified and guaranteed for quality?
A: Each batch of Pramlintide acetate is rigorously identified using HPLC and Mass Spectrometry, ensuring high-quality standards with purity greater than 98% and a single impurity below 1.0%.Q: What are the benefits of using Pramlintide acetate in diabetes management?
A: Pramlintide acetate retains amylin receptor agonist activity, providing optimal glycemic regulation and supporting advanced diabetes mellitus treatment strategies.Q: When should Pramlintide acetate be stored and how long is its shelf life?
A: Pramlintide acetate should be stored at -20C, protected from light and moisture, ensuring a shelf life of up to 2 years when properly handled.Q: Where is Pramlintide acetate supplied from and what packaging options are available?
A: The product is shipped from specified FOB ports with custom packaging options, typically as a lyophilized powder, to ensure stability and convenience during transit.Q: What is the process for ordering and redeeming samples of Pramlintide acetate?
A: To obtain samples, simply contact the supplier, who will coordinate delivery through their tailored sample supply policy, ensuring secure and swift transportation across domestic regions.
Price 100 INR/ Kilograms
- Minimum Order Quantity
- 1 Kilograms
- Supply Ability
- 2000 Kilograms Per Day
- Delivery Time
- 1 Days
Price:
- 50
- 100
- 200
- 250
- 500
- 1000+
More Products in Pharmaceutical API Category
Zopiclone
Price 100 INR / Kilograms
Minimum Order Quantity : 1 Kilograms
Particle Size : NMT 20 microns
Molecular Formula : C17H17ClN6O3
Smell : Other, Odourless
Loss on Drying : NMT 0.5%
Metoprolol Succinate
Price 100 INR / Kilograms
Minimum Order Quantity : 1 Kilograms
Particle Size : 90% passes through 80 mesh
Molecular Formula : C34H56N2O10
Smell : Other, Odorless
Loss on Drying : 0.5%
Acitretin .
Price 100 INR / Kilograms
Minimum Order Quantity : 1 Kilograms
Particle Size : D90 < 10 m
Molecular Formula : C21H26O3
Smell : Other, Odorless
Loss on Drying : 0.5%
Levosalbutamol sulfate
Price 100 INR / Kilograms
Minimum Order Quantity : 1 Kilograms
Particle Size : Not less than 90% passes through 60 mesh
Molecular Formula : C13H21NO3H2SO4
Smell : Other, Odorless
Loss on Drying : 0.5%
![]() |
ANGLE BIO PHARMA
All Rights Reserved.(Terms of Use) Developed and Managed by Infocom Network Private Limited. |










